PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G196500.1
Common NamePHAVU_011G196500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YC
Protein Properties Length: 296aa    MW: 32415.9 Da    PI: 5.0664
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G196500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.41.9e-196861898
               NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                        ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl d+v r
  Phvul.011G196500.1  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNSLHLKHCVQSYNVFDFLRDVVSR 86
                        5789**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.1E-26372IPR009072Histone-fold
SuperFamilySSF471132.92E-20491IPR009072Histone-fold
PfamPF008082.3E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK  60
TMNSLHLKHC VQSYNVFDFL RDVVSRVPDY GHGHGHGHAE AGADDRAISK RRKAVGDDGN  120
DSDEEAKRGK MQEVSHTGST GSRGRGRGRG RGRGRGRPPL VRDTYHQDAE SEPCTSVQPS  180
NQQSANPSVG VDSGSEPKDL PKDLLKEENI AVPVVSTDSL RNIDLNAVTN ENDDKKASVA  240
ADTSLPEPPS TEVKHEEILG WPLSDVDKMA IDSTQLAQLA RPLEEEEEDY DEEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A9e-21272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146155RGRGRGRGRG
2146156RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0946380.0BT094638.1 Soybean clone JCVI-FLGm-18N24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133640.10.0hypothetical protein PHAVU_011G196500g
TrEMBLV7AJB60.0V7AJB6_PHAVU; Uncharacterized protein
STRINGGLYMA15G36170.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.14e-71nuclear factor Y, subunit C11